S22A2_RAT Q9R0W2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R0W2
Recommended name：Solute carrier family 22 member 2 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：29503
Gene names (primary )：Slc22a2
Gene names (synonym )：Oct2
Gene names (ORF )：
Length：555
Mass：62,343
Sequence：MSTVDDILEHIGEFHLFQKQTFFLLALLSGAFTPIYVGIVFLGFTPDHHCWSPGAAKLSQRCGWSQAEELNYTVPGLGPSDEASFLSQCMRYEVDWNQSTLDCVDPLSSLAADRNQLPLGPCEHGWVYNTPGSSIVTEFNLVCAHSWMLDLFQSVVNVGFFIGAMMIGYLADRFGRKFCLLVTILINAISGALMAISPNYAWMLVFRFLQGLVSKAGWLIGYILITEFVGLGYRRMVGICYQIAFTVGLLILAGVAYVIPNWRWLQFAVTLPNFCFLLYFWCIPESPRWLISQNKIVKAMKIIKHIAKKNGKSVPVSLQNLTPDEDAGKKLNPSFLDLVRTPQIRKHTLILMYNWFTSSVLYQGLIMHMGLAGDNIYLDFFYSALVEFPAAFIIILTIDRVGRRYPWAVSNMVAGAACLASVFIPDDLQWLKITIACLGRMGITMAYEMVCLVNAELYPTYIRNLGVLVCSSMCDIGGIITPFLVYRLTDIWMEFPLVVFAVVGLVAGALVLLLPETKGKALPETIEDAENMQRPRKKKEKRIYLQVKQADRPLS
Tissue specificity：Expressed in the kidney, in the proximal tubules of cortex and of the outer medulla (PubMed:10812069, PubMed:11083459, PubMed:11758759, PubMed:16272756, PubMed:8702418, PubMed:9830022). In brain, highly expressed predominantly in regions located at the brain-cerebrospinal fluid border, in the leptomeninges, in the choroid plexus and in a layer boarding the third ventricle. In brain, also observed in the granular cell layer of the cerebellum and in the granular layer and pyramidal cells of the hippocampus in the CA1-CA3 regions (PubMed:16581093). Expressed in tracheal and bronchial ciliated epithelium in the respiratory tract (PubMed:15817714). Expression is greater in the kidney of male than of female (PubMed:16272756). 7 s
Induction：
Developmental stage：Down-regulated in ischemia/reperfusion (I/R) kidneys (PubMed:18180268). Up-regulated by testosterone and moderately down-regulated by estradiol (PubMed:10812069). 2 s
Protein families：major facilitator (TC 2.A.1) superfamily