APLD1_RAT Q6B959
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6B959
Recommended name：Apolipoprotein L domain-containing protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：444983
Gene names (primary )：Apold1
Gene names (synonym )：Verge
Gene names (ORF )：
Length：246
Mass：26,829
Sequence：MEKWTAWEPQGADALRRFQGLLLDRRGRLHCQVLRLREVARRLERLRRRSLAANVAGSSLSAAGALAAIVGLSLSPVTLGASLVASAVGLGVATAGGAVTITSDLSLIFCNSREVRRVQEIAATCQDQMRELLSCLEFFCQWQGRGDRQLLQSGRDASMALYNSVYFIVFFGSRGFLIPRRAEGATKVSQAVLKAKIQKLSESLESCTGALDELSEQLESRVQLCTKAGRGHNLRNSPDLDAALFF
Tissue specificity：Present at low levels in brain vascular cells (at protein level). 1
Induction：Expressed at high levels in vessels from developing heart from 12 dpc to P12. Expression decreases markedly from P12 to P17, and is no longer detectable at P30. 1 Publication
Developmental stage：In the brain, by electrical or chemical seizures (at protein level). 1
Protein families：