CLC7A_MOUSE   Q6QLQ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6QLQ4

Recommended name:C-type lectin domain family 7 member A

EC number:

Alternative names:(Beta-glucan receptor) (C-type lectin superfamily member 12) (Dendritic cell-associated C-type lectin 1) (DC-associated C-type lectin 1) (Dectin-1) (CD antigen CD369)

Cleaved into:

GeneID:

Gene names  (primary ):Clec7a

Gene names  (synonym ):Bgr Clecsf12 Dectin1

Gene names  (ORF ):

Length:244

Mass:27420

Sequence:MKYHSHIENLDEDGYTQLDFSTQDIHKRPRGSEKGSQAPSSPWRPIAVGLGILCFVVVVVAAVLGALGEYGHNSGRNPEEKDNFLSRNKENHKPTESSLDEKVAPSKASQTTGGFSQPCLPNWIMHGKSCYLFSFSGNSWYGSKRHCSQLGAHLLKIDNSKEFEFIESQTSSHRINAFWIGLSRNQSEGPWFWEDGSAFFPNSFQVRNTAPQESLLHNCVWIHGSEVYNQICNTSSYSICEKEL

Tissue specificity:Detected in spleen (at protein level). Highly expressed in dendritic cells, spleen and thymus. Detected in epidermal Langerhans cells. Detected in macrophages, liver and lung. {ECO:0000269|PubMed:10779524, ECO:0000269|PubMed:11544516, ECO:0000269|PubMed:12719479}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp