TM11D_RAT   Q8VHJ4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8VHJ4

Recommended name:Transmembrane protease serine 11D

EC number:EC:3.4.21.-

Alternative names:Adrenal secretory serine protease (AsP) Airway trypsin-like protease (AT)

Cleaved into:

GeneID:

Gene names  (primary ):Tmprss11d

Gene names  (synonym ):Rat

Gene names  (ORF ):

Length:417

Mass:46,288

Sequence:MYRPRSMVSPSRFFNPFMVALIVIITVGLLAMTAGLLIHFLAFDKRAYFYHSNFHILNVDYTEALNSPATHEYRTLSERIESMITDAFRESNLRSEFIRTHVVKLRKEGSGVVADVVMKFRSSKRNNKKAIKTRIQSVLQRLSSSGNLEIAPSNGITSLTDQDTENVLTQECGARPDLITLSEERIIGGTQAETGDWPWQVSLQLNNVHHCGGTLISNLWVLTAAHCFRSYSNPQQWTATFGVSTISPRLRVRVRAILAHAEYNSITRDNDIAVVQLDRPVTFTRNIHRVCLPAATQNIMPDSVAYVTGWGSLTYGGNTVTNLQQGEVRIVSSEVCNEPAGYGGSVLPGMLCAGVRSGAVDACQGDSGGPLVQEDTRRLWFVVGIVSWGYQCGLPNKPGVYTRVTAYRNWIRQQTGI

Tissue specificity:Isoform 1 and isoform 2 are expressed in the esophagus, tongue and trachea. Isoform 2 is also highly expressed in the adrenal cortex and heart. 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp