SC11A_RAT   P42667


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P42667

Recommended name:Signal peptidase complex catalytic subunit SEC11A

EC number:EC:3.4.21.89

Alternative names:Endopeptidase SP18 Microsomal signal peptidase 18 kDa subunit (SPase 18 kDa subunit) SEC11 homolog A SEC11-like protein 1 SPC18

Cleaved into:

GeneID:

Gene names  (primary ):Sec11a

Gene names  (synonym ):Sec11l1, Spc18

Gene names  (ORF ):

Length:179

Mass:20,599

Sequence:MLSLDFLDDVRRMNKRQLYYQVLNFGMIVSSALMIWKGLMLITGSESPIVVVLSGSMEPAFHRGDLLFLTNRVEDPIRVGEIVVFRIEGREIPIVHRVLKIHEKQDGHIKFLTKGDNNAVDDRGLYKQGQHWLEKKDVVGRARGFVPYIGIVTILMNDYPKFSYAVLFLLGLFVLVHRE

Tissue specificity:

Induction:

Developmental stage:

Protein families:peptidase S26B family


   💬 WhatsApp