UFD1_MOUSE P70362
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P70362
Recommended name：Ubiquitin recognition factor in ER-associated degradation protein 1
EC number：
Alternative names：(Ubiquitin fusion degradation protein 1 homolog) (UB fusion protein 1)
Cleaved into：
GeneID：22230
Gene names (primary )：Ufd1
Gene names (synonym )：Ufd1l
Gene names (ORF )：
Length：307
Mass：34481
Sequence：MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLNITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKKGRKP
Tissue specificity：
Induction：
Developmental stage：Expressed at high levels in the otocyst (between 9.5 dpc and 11.5 dpc embryos fading away after 12 dpc) and in the developing eye. Lower expression is found in different sites of the embryos such as developing brain, the lungs and the cardiac outflow tract.
Protein families：UFD1 family