ASH2L_MOUSE   Q91X20


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91X20

Recommended name:Set1/Ash2 histone methyltransferase complex subunit ASH2

EC number:

Alternative names:(ASH2-like protein)

Cleaved into:

GeneID:23808

Gene names  (primary ):Ash2l

Gene names  (synonym ):

Gene names  (ORF ):

Length:623

Mass:68250

Sequence:MAAAGAGPGPGVSAGPGPGAAASATTAEDRETEPVAAGAGEGPSAAPGAEPSSGEAESGDANLVDVSGLETESSNGKDTLEGTGDTSEVMDTQAGSVDEENGRQLGEVELQCGICTKWFTADTFGIDTSSCLPFMTNYSFHCNVCHHSGNTYFLRKQANLKEMCLSALANLTWQSRTQDEHPKTMFSKDKDIIPFIDKYWECMTTRQRPGKMTWPNNIVKTMSKERDVFLVKEHPDPGSKDPEEDYPKFGLLDQDLSNIGPAYDNQKQSSAVSASGNLNGGIAAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFNKDGYRYILAEPDPHAPDPEKLELDCWAGKPIPGDLYRACLYERVLLALHDRAPQLKISDDRLTVVGEKGYSMVRASHGVRKGAWYFEITVDEMPPDTAARLGWSQPLGNLQAPLGYDKFSYSWRSKKGTKFHQSIGKHYSSGYGQGDVLGFYINLPEDTETAKSLPDTYKDKALIKFKSYLYFEEKDFVDKAEKSLKQTPHSEIIFYKNGVNQGVAYRDIFEGVYFPAISLYKSCTVSINFGPSFKYPPKDLTYHPMSDMGWGAVVEHTLADVLYHVETEVDGRRSPPWEP

Tissue specificity:Ubiquitously expressed, with abundant expression in the heart, skeletal muscle and kidney. Low expression is seen in spleen, lung and testis. {ECO:0000269|PubMed:10393421}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp