GHITM_MOUSE   Q91VC9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91VC9

Recommended name:Growth hormone-inducible transmembrane protein

EC number:

Alternative names:(Mitochondrial morphology and cristae structure 1) (MICS1)

Cleaved into:

GeneID:66092

Gene names  (primary ):Ghitm

Gene names  (synonym ):Mics1

Gene names  (ORF ):

Length:346

Mass:37275

Sequence:MLAARLVCLRTLPSRVFQPTFITKASPLVKNSITKNQWLVTPSREYATKTRIRTHRGKTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGMSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSALAVARTPALMNFMMTGSWVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTILGGPLLLRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFASSLGSMFLPPTSVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEITPMYGAQKYDPINSMLTIYMDTLNIFMRVATMLATGSNRKK

Tissue specificity:

Induction:By growth hormone. {ECO:0000269|PubMed:11416014}.

Developmental stage:

Protein families:BI1 family


   💬 WhatsApp