ATIF1_MOUSE   O35143


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O35143

Recommended name:ATPase inhibitor, mitochondrial

EC number:

Alternative names:(ATP synthase F1 subunit epsilon) (Inhibitor of F(1)F(o)-ATPase) (IF(1)) (IF1)

Cleaved into:

GeneID:11983

Gene names  (primary ):Atp5if1

Gene names  (synonym ):Atpi Atpif1 If1

Gene names  (ORF ):

Length:106

Mass:12159

Sequence:MAGSALAVRARFGVWGMKVLQTRGFVSDSSDSMDTGAGSIREAGGAFGKREKAEEDRYFREKTKEQLAALRKHHEDEIDHHSKEIERLQKQIERHKKKIQQLKNNH

Tissue specificity:

Induction:

Developmental stage:

Protein families:ATPase inhibitor family


   💬 WhatsApp