B4GT4_MOUSE   Q9JJ04


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JJ04

Recommended name:Beta-1,4-galactosyltransferase 4

EC number:EC 2.4.1.-

Alternative names:(Beta-1,4-GalTase 4) (Beta4Gal-T4) (b4Gal-T4) (Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase) (Lactotriaosylceramide beta-1,4-galactosyltransferase) (N-acetyllactosamine synthase) (Nal synthase) (UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4) (UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4)

Cleaved into:

GeneID:56375

Gene names  (primary ):B4galt4

Gene names  (synonym ):

Gene names  (ORF ):

Length:344

Mass:39700

Sequence:MGCNPPYHLSYRLRLLLLFTLCLTVVGWATSNYFVGAIQVIPKAKDFMASFHKVIHLGNEETLGHDGATKKPELANCPSVSPNLRGQSKLVFKPDLTLEEIEAENPKVSRGRYHPEECKALQRVAILIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEENWDCFVFHDVDLVPENDFNLYTCGDQPKHLVVGRNSTGYRLRYSKYFGGVTALSREQFLKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNMGRMKLLQQMSRVWKTDGLSSCSYRLLSVEHNPLYANITVDFWTAA

Tissue specificity:

Induction:

Developmental stage:

Protein families:Glycosyltransferase 7 family


   💬 WhatsApp