DESI2_RAT   Q5XIT6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5XIT6

Recommended name:Deubiquitinase DESI2 By Similarity

EC number:EC:3.4.19.12

Alternative names:Desumoylating isopeptidase 2 (DeSI-2) PPPDE peptidase domain-containing protein 1 Palmitoyl protein thioesterase DESI2 (EC:3.1.2.22 By Similarity) . EC:3.1.2.22 (UniProtKB | ENZYME | Rhea) By Similarity Protein FAM152A S-depalmitoylase DESI2

Cleaved into:

GeneID:289277

Gene names  (primary ):Desi2

Gene names  (synonym ):Fam152a, Pppde1

Gene names  (ORF ):

Length:194

Mass:21,418

Sequence:MGANQLVVLNVYDMYWMNEYTSSIGIGVFHSGIEVYGREFAYGGHPYPFSGIFEISPGNAAELGETFKFKEAVVLGSTDFLEDDIEKIVEELGKEYKGNAYHLMHKNCNHFSSALSEILCGKEIPRWINRLAYFSSCIPFLQSCLPKEWLTPAALQSSVSQELQDELEEAEDAAASTAMASAAAGGRTGRHTKL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp