LBX1_MOUSE P52955
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52955
Recommended name：Transcription factor LBX1
EC number：
Alternative names：(Ladybird homeobox protein homolog 1)
Cleaved into：
GeneID：16814
Gene names (primary )：Lbx1
Gene names (synonym )：Lbx1h
Gene names (ORF )：
Length：282
Mass：30262
Sequence：MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAPGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEASGGGGGGGCGRAKSRPGSPALPPGAPQAPGGGPLQLSPASPLTDQRASSQDCSEDEEDEEIDVDD
Tissue specificity：Expressed in the dorsal part of the spinal cord and hindbrain and in presumptive myogenic cells in lateral regions of differentiating somites. {ECO:0000269|PubMed:8645601}.
Induction：
Developmental stage：Expressed in the developing central nervous system from 10.5 dpc to 16.5 dpc. Expressed in presumptive myogenic cells from 9.5 dpc until 16.5 dpc with highest levels at 10.5-11.5 dpc. {ECO:0000269|PubMed:8645601}.
Protein families：