SOX11_MOUSE Q7M6Y2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q7M6Y2
Recommended name：Transcription factor SOX-11
EC number：
Alternative names：
Cleaved into：
GeneID：20666
Gene names (primary )：Sox11
Gene names (synonym )：Sox-11
Gene names (ORF )：
Length：395
Mass：42629
Sequence：MVQQAESSEAESNLPRDALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKTDPAAKPSAGQSPDKSAAGAKAAKGPGKKCAKLKAPAGKAGAGKAAQPGDCAAGKAAKCVFLDDDDEDDDEDDELQLRPKPDADDDDDEPAHSHLLPPPTQQQPPQLLRRYSVAKVPASPTLSSAAESPEGASLYDEVRAGGRLYYSFKNITKQQPPPAPPALSPASSRCVSTSSSSGSSSGSGAEDADDLMFDLSLNFSQGAHSACEQPLGAGAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY
Tissue specificity：Expression prominent in the periventricular cells of the central nervous system, also observed in a wide range of tissues involved in epithelial-mesenchymal interactions.
Induction：
Developmental stage：Expression detected from 8.5 dpc through to 13.5 dpc, with a considerable increase in expression apparent at 13.5 dpc (PubMed:9337129, PubMed:18505825, PubMed:20596238). Expressed throughout the central and peripheral nervous system, as well as the mesenchyme of many developing organs between 12.5 dpc and 14.5 dpc (PubMed:18403418). Abundantly expressed in the developing cerebral cortex, thalamus, hippocampus, cerebellar cortex, and ganglia in the brain at 14.5 dpc and 16.5 dpc with low expression at 18.5 dpc (PubMed:18505825). Abundantly expressed in the gut epithelium at 14.5 dpc (PubMed:18505825). Abundantly expressed in the olfactory epithelium with low expression in skin, spinal cord, kidney, heart, muscle, cartilage from 14.5 dpc to 18.5 dpc (PubMed:18505825). Very low expression in intestine and lung, with no expression detectable at 18.5 dpc (PubMed:18505825). Abundantly expressed in the subventricular zone of the brain at 18.5 dpc (PubMed:18505825). Expressed in the brain at postnatal day 2 (PubMed:18403418). {ECO:0000269|PubMed:18403418, ECO:0000269|PubMed:18505825, ECO:0000269|PubMed:20596238, ECO:0000269|PubMed:9337129}.
Protein families：