AQP11_MOUSE Q8BHH1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BHH1
Recommended name：Aquaporin-11
EC number：
Alternative names：(AQP-11)
Cleaved into：
GeneID：66333
Gene names (primary )：Aqp11
Gene names (synonym )：
Gene names (ORF )：
Length：271
Mass：30481
Sequence：MSALLGLRPEVQDTCISLGLMLLFVLFVGLARVIARQQLHRPVVHAFVLEFLATFQLCCCTHELQVLSEQDSAHPTWTLTLIYFFSLVHGLTLVGTASNPCGVMMQMILGGMSPEMGAVRLLAQLVSALCSRYCISALWSLSLTKYHYDERILACRNPIHTDMSKAIIIEAICSFIFHSALLHFQEVRTKLRIHLLAALITFLAYAGGSLTGALFNPALALSLHFPCFDELFYKFFVVYWLAPSVGVLMMILMFSFFLPWLHNNQMTNKKE
Tissue specificity：Highly expressed in the S1 proximal tubule segment, (PubMed:23486012). Expressed in the testis, kidney, and liver. Weakly expressed in the heart, brain, and muscle. Highly expressed in the testis. Expressed in the proximal tubule of the cortex of 8-day-old mouse kidney (PubMed:16107722). Expressed in retina specifically at retinal Mueller glial cells (PubMed:27107718). Expressed in brain. Expressed abundantly at the choroid plexus but also expressed weakly in the parenchyma. Expressed at the capillary endothelium in the cerebral white matter (PubMed:27258268). Expressed in adult testis, in the elongated spermatids (ES) and in residual bodies inside Sertoli cells (PubMed:19812234). {ECO:0000269|PubMed:16107722, ECO:0000269|PubMed:19812234, ECO:0000269|PubMed:23486012, ECO:0000269|PubMed:27107718, ECO:0000269|PubMed:27258268}.
Induction：Increased by glucose (PubMed:23486012). Decreased by phlorizin (PubMed:23486012). {ECO:0000269|PubMed:23486012}.
Developmental stage：Mainly expressed at the brain surface with a slight expression in the brain parenchyma at postnatal day 1, 7, and 14. At the stage of postnatal day 28, mainly expressed in the parenchyma. {ECO:0000269|PubMed:27258268}.
Protein families：MIP/aquaporin (TC 1.A.8) family, AQP11/AQP12 subfamily