PSRC1_MOUSE Q9D0P7
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9D0P7
Recommended name:Proline/serine-rich coiled-coil protein 1
EC number:
Alternative names:
Cleaved into:
GeneID:56742
Gene names (primary ):Psrc1
Gene names (synonym ):Dda3
Gene names (ORF ):
Length:329
Mass:34707
Sequence:MEDLKEDIKFIVDETLDFGGLSPSDSHEEEDITVLVSPEKPLRRGLAHRSNPNEVAPALQGVRFSLGPLSPEKLEEILDEANRLAAQLEECALKDRERAGTGPGRPSPRGKPSPRRETFVLKDSPVRDLLPTVSSWSTPPPSSLAGLRSSDKKGSARAVRVASGKKPSSIKKESPTCNLFPASKSPGRSPLAQPILPPRRKTGFGARTTASPPIPVRPVPQSSASNSQCSSRLQGAAVKSSSRLPVPSAIPKPATRVPLIGRSLPPGKGALAPDSLSTQKGHPSAIGHRASVSQKTNLPTTSAARGRTTSAARGRAQPLRKAAVPGPTR
Tissue specificity:Highly expressed in heart, brain and lung. Weaker expression in kidney and testis. {ECO:0000269|PubMed:10618717}.
Induction:Induced by adriamycin and mitomycin C, in a p53-dependent manner, in NIH3T3 cells. This induction is inhibited by actinomycin D. Also induced by cisplatin in a p73-dependent manner in embryonic cells. {ECO:0000269|PubMed:10618717, ECO:0000269|PubMed:12082536}.
Developmental stage:
Protein families:PSRC1 family