CIB2_RAT   Q568Z7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q568Z7

Recommended name:Calcium and integrin-binding family member 2

EC number:

Alternative names:

Cleaved into:

GeneID:300719

Gene names  (primary ):Cib2

Gene names  (synonym ):

Gene names  (ORF ):

Length:187

Mass:21,672

Sequence:MGNKQTIFTEEQLDNYQDCTFFNKKDILKLHARFYELAPNLVPMDYRKSPIVHVPMSLIIQMPELRENPFKERIVEAFSEDGEGNLTFNDFVDMFSVLCESAPRELKANYAFKIYDFNTDNFICKEDLELTLARLTKSELDEDEVVLVCDKVIEEADLDGDGKLGFADFEDMIAKAPDFLSTFHIRI

Tissue specificity:Expressed in auditory hair cells at P10 (at protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp