MRM2_MOUSE   Q9CPY0


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9CPY0

Recommended name:rRNA methyltransferase 2, mitochondrial

EC number:EC 2.1.1.-

Alternative names:(16S rRNA (uridine(1369)-2'-O)-methyltransferase) (16S rRNA [Um1369] 2'-O-methyltransferase) (Protein ftsJ homolog 2)

Cleaved into:

GeneID:68017

Gene names  (primary ):Mrm2

Gene names  (synonym ):Ftsj2

Gene names  (ORF ):

Length:246

Mass:27145

Sequence:MAGHLKLVGVPLKVRRLHTAVCHYRGRTGAEHLWLTRHLKDPFVKAAKVESYRCRSAFKLLEMNEKHQILRPGLRVLDCGAAPGAWSQVAVQRVNATGADSSSPVGFVLGVDLLHIFPLAGATFLCPADVTDPRTFQKILELLPSRRADVILSDMAPNATGIRDLDHDKLISLCLTLVDMAVDILHPGGTLLCKTWAGSKSHLLQKRLTQEFQSTRVVKPEASRKESSEVYLLATQYRGGKGTRRP

Tissue specificity:

Induction:

Developmental stage:

Protein families:Class I-like SAM-binding methyltransferase superfamily, RNA methyltransferase RlmE family


   💬 WhatsApp