AFG1L_MOUSE   Q3V384


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q3V384

Recommended name:AFG1-like ATPase

EC number:EC 3.6.-.-

Alternative names:(Lactation elevated protein 1)

Cleaved into:

GeneID:215951

Gene names  (primary ):Afg1l

Gene names  (synonym ):Lace1

Gene names  (ORF ):

Length:480

Mass:54313

Sequence:MAASWSPLVTLRSAARSRLTGRGVGCGARVVAIPPPAPGPGKPLWKAYTVQTSEGVRPTAASEARLKALAVCHGPLDHYDFLIKSQELREDEHQRRVVQCLQKLQEDLKGYSIEEGGLFSKLFSRNKPPKGLYVYGDVGTGKTMVMDMFYAYVETKRKKRVHFHGFMLDVHRRIHHLKQSLPKRKAGFMAKSYDPIAPIAEEISQETSLLCFDEFQVTDIADAMILKQLFENLFKNGVVVVATSNRPPEDLYKNGLQRANFVPFIAVLKEYCDTLQLDSGVDYRKRELAPAGKLYYLTSEADVEAVVDKLFDELAQKQNDLTSPRILKVQGRELRLNKACGSVADCTFEELCERPLGASDYLELSKNFDTVIIRNIPQFSLAKRTQARRFITLIDNFYDFKVRIICSASAPISSLFLHQHQDSESDQSRILMDDLGLSQDSAGLSMFTGEEEIFAFQRTISRLTEMQTEQYWIEGDRSRK

Tissue specificity:Highly expressed in heart, kidney, and lactating breast. Present at reduced levels in virgin, pregnant, and involuting breast. {ECO:0000269|PubMed:12079282}.

Induction:

Developmental stage:Expression is elevated during lactation. {ECO:0000269|PubMed:12079282}.

Protein families:AFG1 ATPase family


   💬 WhatsApp