SNAI3_MOUSE Q9QY31
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QY31
Recommended name：Zinc finger protein SNAI3
EC number：
Alternative names：(Protein snail homolog 3) (Snail-related gene from muscle cells) (Zinc finger protein 293)
Cleaved into：
GeneID：30927
Gene names (primary )：Snai3
Gene names (synonym )：Smuc Zfp293
Gene names (ORF )：
Length：287
Mass：31636
Sequence：MPRSFLVKTHSSHRVPNYGKLETLREANGSCSACKELAGSRHLPDEEAPCNPSDPLQPWDSTSAVACISLPLLPNHRETLGVSGPEPQETSWVGPRAAQAPSVTLKDSFTLPPLLVLPTRWPPILGPDGALNEHLRAEGTSRVPGSFECIHCHRPYHTLAGLARHQQLHCHLPTGRAFTCRYCDKEYASLGALKMHIRTHTLPCICKVCGKAFSRPWLLQGHIRTHTGEKPYTCSHCSRAFADRSNLRAHLQTHVGTKKYRCAVCPKAFSRMSLLARHEEAGCCPGP
Tissue specificity：Highly expressed in skeletal muscle and thymus. Lower expression in heart, lung and spleen. {ECO:0000269|PubMed:10606664}.
Induction：
Developmental stage：Expressed at 7 dpc, higher expression observed in stages 15 dpc and 18 dpc. {ECO:0000269|PubMed:10606664}.
Protein families：Snail C2H2-type zinc-finger protein family