APEL_RAT Q9R0R3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R0R3
Recommended name：Apelin
EC number：
Alternative names：Apelin-36 Apelin-31 Apelin-28 Apelin-13
Cleaved into：
GeneID：58812
Gene names (primary )：Apln
Gene names (synonym )：Apel
Gene names (ORF )：
Length：77
Mass：8,677
Sequence：MNLSFCVQALLLLWLSLTAVCGVPLMLPPDGKGLEEGNMRYLVKPRTSRTGPGAWQGGRRKFRRQRPRLSHKGPMPF
Tissue specificity：Expressed in the lung, testis, ovary, uterus and mammary gland (PubMed:11336787). Expressed in neurons in the thalamic paraventricular and hypothalamic supraoptic nuclei (PubMed:11359874). The lung, testis and uterus mainly contain a large form that looks like apelin-36, whereas the mammary gland seems to contain 2 forms of apelin, a large form close to apelin-36 and a small form close to apelin-13 (at protein level) (PubMed:11336787). Widely expressed in the adult, with highest levels in the mammary gland of lactating animals, very high levels in the lung, intermediate levels in the spinal cord, ovary, adipose tissue, brain (neuronal cell bodies and fibers in the supraoptic and the paraventricular nuclei), heart and testis, and lowest levels in the pituitary gland, kidney, stomach, uterus and pancreas (PubMed:10525157, PubMed:10617103, PubMed:11336787). 4 s
Induction：Highly expressed in neonatal tissues. In the adult, reaches a maximal level around parturition.
Developmental stage：During pregnancy and lactation (PubMed:10525157). 1
Protein families：