AK1A1_MOUSE Q9JII6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JII6
Recommended name：Aldo-keto reductase family 1 member A1
EC number：EC 1.1.1.2
Alternative names：(Alcohol dehydrogenase [NADP(+)]) (Aldehyde reductase) (Glucuronate reductase) (Glucuronolactone reductase) (EC 1.1.1.20)
Cleaved into：
GeneID：58810
Gene names (primary )：Akr1a1
Gene names (synonym )：Akr1a4
Gene names (ORF )：
Length：325
Mass：36587
Sequence：MTASSVLLHTGQKMPLIGLGTWKSEPGQVKAAIKHALSAGYRHIDCASVYGNETEIGEALKESVGSGKAVPREELFVTSKLWNTKHHPEDVEPALRKTLADLQLEYLDLYLMHWPYAFERGDNPFPKNADGTVRYDSTHYKETWKALEVLVAKGLVKALGLSNFNSRQIDDVLSVASVRPAVLQVECHPYLAQNELIAHCHARGLEVTAYSPLGSSDRAWRHPDEPVLLEEPVVLALAEKHGRSPAQILLRWQVQRKVICIPKSINPSRILQNIQVFDFTFSPEEMKQLDALNKNWRYIVPMITVDGKRVPRDAGHPLYPFNDPY
Tissue specificity：Widely expressed. {ECO:0000269|PubMed:10842086, ECO:0000269|PubMed:15769935}.
Induction：Fear memory increases expression 7-fold. {ECO:0000269|PubMed:11533224}.
Developmental stage：Detected at high levels in several tissues including neural ectoderm, gut endoderm, somites, branchial arches, otic vesicles, limb buds and tail bud. {ECO:0000269|PubMed:10842086}.
Protein families：Aldo/keto reductase family