TCF7_MOUSE   Q00417


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q00417

Recommended name:Transcription factor 7

EC number:

Alternative names:(TCF-7) (T-cell-specific transcription factor 1) (T-cell factor 1) (TCF-1)

Cleaved into:

GeneID:21414

Gene names  (primary ):Tcf7

Gene names  (synonym ):Tcf-1 Tcf1

Gene names  (ORF ):

Length:419

Mass:45465

Sequence:MPQLDSGGGGAGRGDDLGAPDELLAFQDEGEEQDDKNRDSPVGPERDLAELKSSLVNESEGAAAGAGVPGPGVRVHGEAEGAPEALGREHTSQRLFPDKLPESLEDGLKAPECTSGMYKETVYSAFNLLMPYPPASGAGQHPQPQPPLHNKPGQPPHGVPQLSPLYEHFSSPHPTPAPADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAPGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRNLKTQAEPKAEKEAKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPMTVL

Tissue specificity:T-cell specific. Expressed in triple negative 2 subpopulations of T-cells and both the gamma-delta and alpha-beta T-cell lineages (PubMed:17218525). Expressed in Il7 receptor positive innate-like T-cells in the mesenteric lymph nodes and spleen (at protein level) (PubMed:23562159). {ECO:0000269|PubMed:17218525, ECO:0000269|PubMed:23562159}.

Induction:

Developmental stage:Expressed in the yolk sac. {ECO:0000269|PubMed:30413363}.

Protein families:TCF/LEF family


   💬 WhatsApp