OX26_RAT P83860
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P83860
Recommended name:Orexigenic neuropeptide QRFP
EC number:
Alternative names:QRF-amide Alternative names: Neuropeptide RF-amide, Pyroglutamylated arginine-phenylalanine-amide peptide
Cleaved into:
GeneID:379044
Gene names (primary ):Qrfp
Gene names (synonym ):P518
Gene names (ORF ):
Length:124
Mass:13,653
Sequence:MRCLCSWLCLLLPLSACFPLLDRRGPTDIGDIGARMSWVQLTEGHTPRSVQSPRPQALLVVAKEQQASRREHTGFRLGRQDSGSEATGFLPTDSEKASGPLGTLAEELSSYSRRKGGFSFRFGR
Tissue specificity:Expressed in the brain with highest expression levels in the hypothalamus and optic nerve. Also expressed in the trachea and mammary gland. 2 s
Induction:
Developmental stage:
Protein families: