MYCT1_MOUSE Q8R411
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R411
Recommended name：Myc target protein 1
EC number：
Alternative names：(Myc target in myeloid cells protein 1)
Cleaved into：
GeneID：68632
Gene names (primary )：Myct1
Gene names (synonym )：Mtmc1
Gene names (ORF )：
Length：188
Mass：21079
Sequence：MANNTTSLGSPWPENFWEDLIMSFTVSVAIGLAIGGFLWALFVFLSRRRRASAPISQWSPTRRPRSSYNHGLNRTGFYRHSGYERRSNLSLASLTFQRQASMELVNSFPRKSSFRASTFHPFLQCPPLPVETESQLMTLSASTTPSTLSTAHSPSRPDFRWSSNSLRMGLSTPPPPAYESIIKAFPDS
Tissue specificity：Highly expressed in lung, heart, and skeletal muscle. Expressed in brain, eye, liver, kidney, smooth muscle, pancreas, thyroid, thymus, submaxillary gland, spleen, testis, ovary, prostate, epididymis, and uterus. Deregulated expression promotes apoptosis in response to growth factor deprivation. Overexpression in synergy with CCNB1 may promote genomic instability. {ECO:0000269|PubMed:11909865}.
Induction：
Developmental stage：Low levels of expression seen in 7-, 11-, 15- and 17-day embryos. {ECO:0000269|PubMed:11909865}.
Protein families：MYCT1 family