SIX6_MOUSE Q9QZ28
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QZ28
Recommended name：Homeobox protein SIX6
EC number：
Alternative names：(Optic homeobox 2) (Sine oculis homeobox homolog 6) (Six9 protein)
Cleaved into：
GeneID：20476
Gene names (primary )：Six6
Gene names (synonym )：Optx2 Six9
Gene names (ORF )：
Length：246
Mass：27741
Sequence：MFQLPILNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRRQRDRAAAAKNRLQQQVLSQGPGRVLRSEGEGTPEVLGVASSPAASLSSKAATSAISITSSDSECDI
Tissue specificity：In the developing embryo, expressed mainly in the ventral optic stalk, optic chiasma, the neural retina and the primordial tissues that give rise to the pituitary/hypothalamus axis. Not expressed in the lens placode. {ECO:0000269|PubMed:10381575, ECO:0000269|PubMed:10473118}.
Induction：
Developmental stage：Expression is first detected in the embryo at 8 dpc. {ECO:0000269|PubMed:10381575}.
Protein families：SIX/Sine oculis homeobox family