ZBT7A_RAT   Q9QZ48


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QZ48

Recommended name:Zinc finger and BTB domain-containing protein 7A Curated

EC number:

Alternative names:

Cleaved into:

GeneID:117107

Gene names  (primary ):Zbtb7a

Gene names  (synonym ):Lrf, Oczf 1 Publication, Zbtb7

Gene names  (ORF ):

Length:569

Mass:60,543

Sequence:MAGGVDGPIGIPFPDHSSDILSGLNEQRTQGLLCDVVILVEGREFPTHRSVLAACSQYFKKLFTSGAVVDQQNVYEIDFVSAEALTALMDFAYTATLTVSTANVGDILSAARLLEIPAVSRVCTDLLERQILAADDVGDAGQPDGAGPTDQRNLLRAKEYLEFFRSNPMNSLPPTAFQWPGFSAPDDDLDATKEAVAAAVAAVAAGDCNGLDFYGPGPPADRPPTGDGEEGDSTPGLWPERDEDAPPGGLFPPPTAPPATTQNGHYGRAGASTGEEEAVALSEAAPEPGDSPGFLSGAAEGEDGDAADVDGLAASTLLQQMMSSVGRAGDSDEESRPDDKGVMDYYLKYFSGAHEGDVYPAWSQKGEKKIRAKAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMRKHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDHLHRHLKKDGCNGVPSRRGRKPRVRGVPPDVPSGAGAPPGLPDAPRNGQEKHFKDEEDDEEEASLDGLGRLNVAGSGGDDGAGGPTVAATEGNFAT

Tissue specificity:Expressed in osteoclasts and kidney cells. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp