DNJB1_MOUSE Q9QYJ3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9QYJ3
Recommended name:DnaJ homolog subfamily B member 1
EC number:
Alternative names:(Heat shock 40 kDa protein 1) (HSP40) (Heat shock protein 40)
Cleaved into:
GeneID:81489
Gene names (primary ):Dnajb1
Gene names (synonym ):Hsp40 Hspf1
Gene names (ORF ):
Length:340
Mass:38167
Sequence:MGKDYYQTLGLARGASDDEIKRAYRRQALRYHPDKNKEPGAEEKFKEIAEAYDVLSDPRKREIFDRYGEEGLKGGSPSGGSSGGANGTSFSYTFHGDPHAMFAEFFGGRNPFDTFFGQRNGEEGMDIDDTFSSFPMGMGGFTNMNFGRSRPSQEPTRKKQDPPVTHDLRVSLEEIYSGCTKKMKISHKRLNPDGKSIRNEDKILTIEVKRGWKEGTKITFPKEGDQTSNNIPADIVFVLKDKPHNIFKRDGSDVIYPARISLREALCGCTVNVPTLDGRTIPVVFKDVIRPGMRRKVPGEGLPLPKTPEKRGDLVIEFEVIFPERIPVSSRTILEQVLPI
Tissue specificity:
Induction:By heat shock. {ECO:0000250}.
Developmental stage:
Protein families: