T4S4_RAT   Q9EQL5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9EQL5

Recommended name:Transmembrane 4 L6 family member 4

EC number:

Alternative names:

Cleaved into:

GeneID:116467

Gene names  (primary ):Tm4sf4

Gene names  (synonym ):Lrtm4

Gene names  (ORF ):

Length:202

Mass:21,484

Sequence:MCTGGCARCLGGTLIPLAVFAVLANILLFFPGGKVVDDNSHLSDEVWYFGGILGSGVLMIFPALVFLGLQNNDCCGCCGNESCGKRFAMFTSTLFAVVGFLGAAYSFIVSAVSINKGPKCFMTNNTWGYPFHDGDYLNDQALWSKCEEPRDVVPWNLTLFSILLVIGGIQMVLCAIQVINGLLGTLCGDCQCCGCCGGDRPV

Tissue specificity:Expressed in liver and testis. Up-regulated in regenerating liver after partial hepatectomy. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp