XPP2_MOUSE B1AVD1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:B1AVD1
Recommended name：Xaa-Pro aminopeptidase 2
EC number：EC 3.4.11.9
Alternative names：(Membrane-bound aminopeptidase P) (Membrane-bound APP) (mAPP) (X-prolyl aminopeptidase 2)
Cleaved into：
GeneID：170745
Gene names (primary )：Xpnpep2
Gene names (synonym )：
Gene names (ORF )：
Length：674
Mass：76434
Sequence：MAQAYWQCYPWLVLLCACAWSYPEPKYLGREDVRNCSTSPERLPVTAVNTTMRLAALRQQMETWNLSAYIIPDTDAHMSEYIGKPDKRREWISGFTGSAGTAVVTMGKAAVWTDSRYWTQAERQMDCNWELHKEVSISSIVAWILAEVPDGQNVGFDPFLFSVDSWKNYDQGFQDSSRHLLSVTTNLVDVAWGSERPPVPSQPIYALPKEFTGSTWQEKVSAVRSYMEHHAKTPTGVLLSALDETAWLFNLRSSDIPYNPFFYSYALLTNSSIRLFVNKSRFSLETLQYLNTNCTLPMCVQLEDYSQVRDSVKAYASGDVKILIGVSYTTYGVYEVIPKEKLVTDTYSPVMLIKAVKNSKEQALLKSSHVRDAVAVIQYLVWLEKNVPKGTVDEFSGAEYIDELRRNENFSSGPSFETISASGLNAALAHYSPTKELHRKLSSDEMYLVDSGGQYWDGTTDITRTVHWGTPTAFQKEAYTRVLMGNIDLSRLVFPAATSGRVIEAFARRALWEVGLNYGHGTGHGIGNFLCVHEWPVGFQYNNIAMAKGMFTSIEPGYYHDGEFGIRLEDVALVVEAKTKYPGDYLTFELVSFVPYDRNLIDVRLLSPEQLQYLNRYYQTIRENVGPELQRRQLLEEFAWLEQHTEPLSARAPHIISWTSLWVASALAILSWSS
Tissue specificity：Strongly expressed in small intestine, heart and lung. Also detected in testis, skeletal muscle, spleen, liver, kidney, brain, uterus, eye, lymph node, thymus, stomach, prostate and bone marrow. {ECO:0000269|PubMed:12941294}.
Induction：
Developmental stage：Expressed in embryos from 7 days onwards, with highest expression at 15 days. {ECO:0000269|PubMed:12941294}.
Protein families：Peptidase M24B family