NNAT_MOUSE Q61979
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q61979
Recommended name：Neuronatin
EC number：
Alternative names：
Cleaved into：
GeneID：18111
Gene names (primary )：Nnat
Gene names (synonym )：
Gene names (ORF )：
Length：81
Mass：9211
Sequence：MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAHTVSRTGRQVLGERRQRAPN
Tissue specificity：Highest in brain and ovary.
Induction：
Developmental stage：Expressed in rhombomeres 3 and 5 during early hindbrain development and in the floor of the foregut pocket. Also expressed in the early Rathke pouch, derived adenohypophysis, and developing inner ear. During later embryogenesis, strongly expressed in the major part of the central and peripheral nervous system.
Protein families：Neuronatin family