TRM61_RAT   Q6AY46


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6AY46

Recommended name:tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A

EC number:EC:2.1.1.220

Alternative names:mRNA methyladenosine-N(1)-methyltransferase catalytic subunit TRMT61A (EC:2.1.1.- By Similarity) . EC:2.1.1.- (UniProtKB | ENZYME | Rhea) By Similarity tRNA(m1A58)-methyltransferase subunit TRMT61A (tRNA(m1A58)MTase subunit TRMT61A)

Cleaved into:

GeneID:314462

Gene names  (primary ):Trmt61a

Gene names  (synonym ):Trm61

Gene names  (ORF ):

Length:290

Mass:31,619

Sequence:MSFVAYEELIKEGDTAILSLGHGSMVAVRVQRGAQTQTRHGVLRHSVDLIGRPFGSKVTCSRGGWVYVLHPTPELWTVNLPHRTQILYSTDIALITMMLELRPGSVVCESGTGSGSVSHAIIRSIAPTGHLHTVEFHQQRADKAREEFQQHRVSQWVTVHTQDVCRSGFGVVHVADAVFLDIPSPWEAVGHAWDALKVEGGRFCSFSPCIEQVQRTCQALAAHGFTELSTLEVLPQVYNVRTVSLPLPDLGADDLEGNVGSDATPFRSGTPMKETVGHTGYLTFATKTPG

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp