COMD5_RAT   Q9ERR2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9ERR2

Recommended name:COMM domain-containing protein 5

EC number:

Alternative names:

Cleaved into:

GeneID:245974

Gene names  (primary ):Commd5

Gene names  (synonym ):

Gene names  (ORF ):

Length:224

Mass:24,453

Sequence:MSALGAAAPYLHHPADSHSGRVSFLGSQPSPEVTAVAQLLKDLDRSTFRKLLKLVVGALHGKDCREAVEQLGASANLSEERLAVLLAGTHTLLQQALRLPPASLKPDAFQEELQELGIPQDLIGDLASLAFGSQRPLLDSVAQQQGSSLPHVSYFRWRVDVAISTSAQSRSLQPSVLMQLKLTDGSAHRFEVPIAKFQELRYSVALVLKEMAELEKKCERKLQD

Tissue specificity:Expressed in the zona fasciculata and medulla of the adrenal gland; expressed in kidney proximal tubules. Basal expression is higher in hypertensive than in normotensive animals. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp