FOXI2_RAT Q63248
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63248
Recommended name：Forkhead box protein I2
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Foxi2
Gene names (synonym )：Foxi1, Hfh5
Gene names (ORF )：
Length：101
Mass：11,988
Sequence：LVRPPYSYSALIAMAIQSAPRRRLTLSQIYQYVAGNFPFYKRTKAGWQNSIRHNLSLNDCFKKVPRDENDPGKGNYWMLDPNCEKMFDNGNFRRKRRRRGE
Tissue specificity：Low levels in lung and liver. 1
Induction：
Developmental stage：
Protein families：