VDAC3_RAT Q9R1Z0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R1Z0
Recommended name：Non-selective voltage-gated ion channel VDAC3 Curated
EC number：
Alternative names：Outer mitochondrial membrane protein porin 3
Cleaved into：
GeneID：
Gene names (primary )：Vdac3
Gene names (synonym )：
Gene names (ORF )：
Length：283
Mass：30,798
Sequence：MCSTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLETKYKVCNYGLIFTQKWNTDNTLGTEISWENKLAEGLKLTVDTIFVPNTGKKSGKLKASYRRDCFSVGSKVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLCQNNFALGYKAEDFQLHTHVNDGTEFGGSIYQRVNEKIETSINLAWTAGSNNTRFGIAAKYRLDCRTSLSAKVNNASLIGLGYTQSLRPGVKLTLSALVDGKNFNAGGHKVGLGFELEA
Tissue specificity：Isoform 1 is widely expressed with strong expression in atrium and ascitic tumor, lower levels in brain and very low levels in liver and kidney (PubMed:10998068). Isoform 2 is also widely expressed with highest levels in brain but no expression in kidney (PubMed:10998068). Also expressed in flagella of epididymal sperm (PubMed:19423663). 2 s
Induction：
Developmental stage：
Protein families：eukaryotic mitochondrial porin family