MEF2B_MOUSE O55087
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O55087
Recommended name：Myocyte-specific enhancer factor 2B
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Mef2b
Gene names (synonym )：
Gene names (ORF )：
Length：349
Mass：37435
Sequence：MGRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCDIALIIFNSAQRLFQYASSDMDRVLLKYTEYSEPHESRTNADILQTLKRRGVGLDGPELDMEEGPEGPGEKLLRTLGGDRGSASPRPRIYPVAPAMSVSELSYRVPPATPGCDPGGLGEVPSVHSRPAYFRPPGLGHPIFSPSHLASKTPPPLYLATDGRRPDLPPGLVGARGGLGTSRSLYSGLQSPGAPGPALGSFAFLPSGSTDCSPGDAAQGPLQPSPWPPTRDAVDPARPVARSLCKEGPPSRGASPPTPPVSIKSERLSPVTGTSGDFPRSFPYPLLLARPLAEPLRPSASLHRLTPDSWPR
Tissue specificity：Highest expression found in embryonic heart and skeletal muscle. Low levels found in adult spleen, lung and testis while no expression is found in adult heart, brain or skeletal muscle. {ECO:0000269|PubMed:7646512, ECO:0000269|PubMed:8668199, ECO:0000269|PubMed:9443808}.
Induction：
Developmental stage：Higher expression in early embryo than in adult. {ECO:0000269|PubMed:9443808}.
Protein families：MEF2 family