KMCP1_MOUSE Q9CR58
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9CR58
Recommended name：Kidney mitochondrial carrier protein 1
EC number：
Alternative names：(Solute carrier family 25 member 30)
Cleaved into：
GeneID：67554
Gene names (primary )：Slc25a30
Gene names (synonym )：Kmcp1
Gene names (ORF )：
Length：291
Mass：32282
Sequence：MSALNWKPFVYGGLASITAECGTFPIDLTKTRLQIQGQTNDANFREIRYRGMLHALMRIGREEGLKALYSGIAPAMLRQASYGTIKIGTYQSLKRLAVERPEDETLLVNVVCGILSGVISSAIANPTDVLKIRMQAQNSAVQGGMIDSFMSIYQQEGTRGLWKGVSLTAQRAAIVVGVELPVYDITKKHLILSGLMGDTVATHFLSSFTCGLVGALASNPVDVVRTRMMNQRALRDGRCAGYKGTLDCLLQTWKNEGFFALYKGFWPNWLRLGPWNIIFFLTYEQLKKLDL
Tissue specificity：Present in kidney (at protein level). Expressed predominantly within the kidney cortex in the proximal and distal tubules and at lower levels in the testis and white adipose tissue. {ECO:0000269|PubMed:15809292}.
Induction：Up-regulated during fasting and in the regenerative phase following renal tubular injury. {ECO:0000269|PubMed:15809292}.
Developmental stage：
Protein families：Mitochondrial carrier (TC 2.A.29) family