NPS_RAT   P0C0P7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P0C0P7

Recommended name:Neuropeptide S

EC number:

Alternative names:

Cleaved into:

GeneID:100360071

Gene names  (primary ):Nps

Gene names  (synonym ):

Gene names  (ORF ):

Length:89

Mass:9,763

Sequence:MIGSLKLNLILALSLSVVHVIWSYPVLSSKVPGKPDYFLILLSTCPARLEGSDGLAFLKPILEKTSMKRSFRNGVGSGVKKTSFRRAKQ

Tissue specificity:Expressed in mammary, salivary and thyroid gland. Expressed in the brain, in a cluster of cells located between the locus coeruleus (LC) and Barrington's nucleus, as well as in few cells of the dorsomedial hypothalamic nucleus and the amygdala. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp