CCND2_RAT Q04827
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q04827
Recommended name：G1/S-specific cyclin-D2
EC number：
Alternative names：
Cleaved into：
GeneID：64033
Gene names (primary )：Ccnd2
Gene names (synonym )：Vin-1
Gene names (ORF )：
Length：288
Mass：32,826
Sequence：MELLCCEVDPVRRAVPDRNLLEDRVLQNLLTIEERYLPQCSYFKCVQKDIQPYMRRMVATWMLEVCEEQKCEEEVFPLAMNYLDRFLAGVPTPKTHLQLLGAVCMFLASKLKETIPLTAEKLCIYTDNSVKPQELLEWELVVLGKLKWNLAAVTPHDFIEHILRKLPQQKEKLSLIRKHAQTFIALCATDFKFAMYPPSMIATGSVGAAICGLQQDEEVNALTCDALTELLTKITHTDVDCLKACQEQIEAVLLNSLQQFRQEQHNGSKSVEDPDQATTPTDVRDVDL
Tissue specificity：
Induction：
Developmental stage：
Protein families：