ARL5A_RAT P51646
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P51646
Recommended name：ADP-ribosylation factor-like protein 5A
EC number：
Alternative names：
Cleaved into：
GeneID：117050
Gene names (primary )：Arl5a
Gene names (synonym )：Arl5
Gene names (ORF )：
Length：179
Mass：20,714
Sequence：MGILFTRIWRLFNHQEHKVIIVGLDNAGKTTILYQFSMNEVVHTSPTIGSNVEEIVVNNTRFLMWDIGGQESLRSSWNTYYTNTEFVIVVVDSTDRERISVTREELYKMLAHEDLRKAGLLIFANKQDVKECMTVAEISQFLKLTSIKDHQWHIQACCALTGEGLCQGLEWMMSRLKIR
Tissue specificity：Low amounts were found in most tissues examined with highest levels in brain, intestine and thymus.
Induction：
Developmental stage：
Protein families：