ELOV5_MOUSE   Q8BHI7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8BHI7

Recommended name:Elongation of very long chain fatty acids protein 5

EC number:EC 2.3.1.199

Alternative names:(3-keto acyl-CoA synthase Elovl5) (ELOVL fatty acid elongase 5) (ELOVL FA elongase 5) (Very long chain 3-ketoacyl-CoA synthase 5) (Very long chain 3-oxoacyl-CoA synthase 5)

Cleaved into:

GeneID:68801

Gene names  (primary ):Elovl5

Gene names  (synonym ):

Gene names  (ORF ):

Length:299

Mass:35332

Sequence:MEHFDASLSTYFKAFLGPRDTRVKGWFLLDNYIPTFVCSVIYLLIVWLGPKYMKNRQPFSCRGILQLYNLGLTLLSLYMFYELVTGVWEGKYNFFCQGTRSAGESDMKIIRVLWWYYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATMLNIWWFVMNWVPCGHSYFGATLNSFIHVLMYSYYGLSSIPSMRPYLWWKKYITQGQLVQFVLTIIQTTCGVFWPCSFPLGWLFFQIGYMISLIALFTNFYIQTYNKKGASRRKDHLKGHQNGSVAAVNGHTNSFPSLENSVKPRKQRKD

Tissue specificity:

Induction:

Developmental stage:

Protein families:ELO family, ELOVL5 subfamily


   💬 WhatsApp