APJ_RAT Q9JHG3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JHG3
Recommended name：Apelin receptor
EC number：
Alternative names：
Cleaved into：
GeneID：83518
Gene names (primary )：Aplnr
Gene names (synonym )：Agtrl1, Apj
Gene names (ORF )：
Length：377
Mass：42,349
Sequence：MEDDGYNYYGADNQSECDYADWTPSGALIPAIYILVFLLGTTGNGLVLWTVFWSSREKRRSADIFIASLAVADLTFVVTLPLWATYTYREFDWPFGTFSCKLSSYLIFVNMYASVFCLTGLSFDRYLAIVRPVANARLRLRVSGAVATAVLWVLAALLAVPVMVFRSTDIPENSTKTQCYMDYSMVATSNSEWAWEVGLGVSSTAVGFVVPFIIMLTCYFFIAQTIAGHFRKERIEGLRKRRRLLSIIVVLVVTFALCWMPYHLVKTLYMLGNLLHWPCDFDSFLMNVFPYCTCISYVNSCLNPFLYAFFDPRFRRACTSMLCCDQSGCKGSPHSSSAEKSASYSSGHSQGPGPNMCKGGEPMHEKSIPYSQETLVD
Tissue specificity：Widely expressed. Highest expression in the lung, lower in the heart, placenta, ovary, skeletal muscle, mammary gland, kidney and several structures in the brain as the hypothalamus (supraoptic and periventricular nuclei), pituitary, olfactory bulb and pineal gland. 1
Induction：
Developmental stage：Higher expression in neonates than in adult. 1
Protein families：G-protein coupled receptor 1 family