WFDC1_RAT O70280
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70280
Recommended name：WAP four-disulfide core domain protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：171112
Gene names (primary )：Wfdc1
Gene names (synonym )：Ps20
Gene names (ORF )：
Length：212
Mass：23,230
Sequence：MGSCDRKALWALSFLLLLLGSSSVQGTWEAMLPVRLAEKSQAEEVAATGSRQPHADRCPPPPRTLPPGACQATRCQSDSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILQPGDAAQGIPNHGRCVKQRRQAEGRVLRQKLHKEYPEGDSKYVAEPGKGQQRHFP
Tissue specificity：Vascular smooth muscle and prostate. Periacinar ring.
Induction：
Developmental stage：
Protein families：