WFDC1_RAT   O70280


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:O70280

Recommended name:WAP four-disulfide core domain protein 1

EC number:

Alternative names:

Cleaved into:

GeneID:171112

Gene names  (primary ):Wfdc1

Gene names  (synonym ):Ps20

Gene names  (ORF ):

Length:212

Mass:23,230

Sequence:MGSCDRKALWALSFLLLLLGSSSVQGTWEAMLPVRLAEKSQAEEVAATGSRQPHADRCPPPPRTLPPGACQATRCQSDSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILQPGDAAQGIPNHGRCVKQRRQAEGRVLRQKLHKEYPEGDSKYVAEPGKGQQRHFP

Tissue specificity:Vascular smooth muscle and prostate. Periacinar ring.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp