PP14C_MOUSE Q8R4S0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8R4S0
Recommended name：Protein phosphatase 1 regulatory subunit 14C
EC number：
Alternative names：(Kinase-enhanced PP1 inhibitor) (PKC-potentiated PP1 inhibitory protein)
Cleaved into：
GeneID：76142
Gene names (primary )：Ppp1r14c
Gene names (synonym )：Kepi
Gene names (ORF )：
Length：164
Mass：17754
Sequence：MSVVTGGGEAAGGGGGGGARVFFQSPRGGTGGSPGSSSSSGSSREDSAPVTTVAAAGQVQQQQRRHQQGKVTVKYDRKELRKRLVLEEWIVEQLGQLYGCEEEEMPDVEIDIDDLLDANSEEERASKLQEALVDCYKPTEEFIRELLSRIRGMRKLSPPQKKSV
Tissue specificity：Detected in heart, muscle, spinal cord, hippocampus, hypothalamus, thalamus, midbrain, brain stem, cerebellum, brain cortex and olfactory bulb. {ECO:0000269|PubMed:11812771}.
Induction：Up-regulated by morphine. {ECO:0000269|PubMed:11812771}.
Developmental stage：
Protein families：PP1 inhibitor family