SG2A2_RAT P02780
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P02780
Recommended name：Secretoglobin family 2A member 2
EC number：
Alternative names：
Cleaved into：
GeneID：361725
Gene names (primary )：Scgb2a2
Gene names (synonym )：Psbpc3
Gene names (ORF )：
Length：95
Mass：10,731
Sequence：MKLVFLFLLVTIPICCYASGSGCSILDEVIRGTINSTVTLHDYMKLVKPYVQDHFTEKAVKQFKQCFLDQTDKTLENVGVMMEAIFNSESCQQPS
Tissue specificity：Highly expressed in ventral prostate. 1
Induction：
Developmental stage：Androgen dependent, as shown by the decrease in the level of the protein following castration. 1
Protein families：