IL17F_MOUSE   Q7TNI7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TNI7

Recommended name:Interleukin-17F

EC number:

Alternative names:(IL-17F)

Cleaved into:

GeneID:257630

Gene names  (primary ):Il17f

Gene names  (synonym ):

Gene names  (ORF ):

Length:161

Mass:17941

Sequence:MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA

Tissue specificity:Expressed by T-helper 17 cells (Th17) (at protein level). The expression pattern reflects the differentiation state. In fully differentiated Th17 cells, IL17A-IL17F heterodimers are produced at higher levels than IL17A-IL17A and IL17F-IL17F dimers (PubMed:18025225). Dominantly secreted in intestine (PubMed:29915298). Expressed by resident cells of the lamina propria, both epithelial cells and immune cell subsets including natural killer cells, dendritic cells, macrophages and various T and B cell subsets (PubMed:29915298, PubMed:16990136). Expressed by epithelial cells and innate immune cells in the colon (PubMed:19144317). Expressed in group 3 innate lymphoid cells (PubMed:23255360, PubMed:29915298). {ECO:0000269|PubMed:16990136, ECO:0000269|PubMed:18025225, ECO:0000269|PubMed:19144317, ECO:0000269|PubMed:23255360, ECO:0000269|PubMed:29915298}.

Induction:Induced upon antigen receptor binding in the presence of IL6 and TGB1 (PubMed:16990136, PubMed:18025225). Up-regulated by IL23A-IL12B, IL1B and TNF and inhibited by IFNG and IL4 in CD4-positive T cells (PubMed:18025225). Induced upon fungal infection in innate lymphoid cells (PubMed:23255360). Induced in lung epithelial cells upon bacterial and fungal infection (PubMed:28813677). Induced in brown adipose tissue upon cold exposure (PubMed:32076265). {ECO:0000269|PubMed:16990136, ECO:0000269|PubMed:18025225, ECO:0000269|PubMed:23255360, ECO:0000269|PubMed:28813677, ECO:0000269|PubMed:32076265}.

Developmental stage:

Protein families:IL-17 family


   💬 WhatsApp