SC11C_RAT   Q9WTR7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9WTR7

Recommended name:Signal peptidase complex catalytic subunit SEC11C

EC number:EC:3.4.21.89

Alternative names:Microsomal signal peptidase 21 kDa subunit (SPase 21 kDa subunit) SEC11 homolog C SEC11-like protein 3 SPC21

Cleaved into:

GeneID:266758

Gene names  (primary ):Sec11c

Gene names  (synonym ):Sec11l3, Spc21

Gene names  (ORF ):

Length:192

Mass:21,646

Sequence:MVRAGAVGTHLPTSSLDIFGDLRKMNKRQLYYQVLNFAMIVSSALMIWKGLIVLTGSESPIVVVLSGSMEPAFHRGDLLFLTNFREDPIRAGEIVVFKVEGRDIPIVHRVIKVHEKDNGDIKFLTKGDNNEVDDRGLYKEGQNWLEKKDVVGRARGFLPYVGMVTIIMNDYPKFKYALVAVMGAYVLLKRES

Tissue specificity:

Induction:

Developmental stage:

Protein families:peptidase S26B family


   💬 WhatsApp