PTTG1_RAT   P97613


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97613

Recommended name:Securin

EC number:

Alternative names:

Cleaved into:

GeneID:64193

Gene names  (primary ):Pttg1

Gene names  (synonym ):Pttg

Gene names  (ORF ):

Length:199

Mass:21,571

Sequence:MATLIFVDKDNEEPGSRLASKDGLKLGSGVKALDGKLQVSTPRVGKVFGAPGLPKASRKALGTVNRVTEKPVKSSKPLQSKQPTLSVKKITEKSTKTQGSAPAPDDAYPEIEKFFPFDPLDFESFDLPEEHQISLLPLNGVPLMILNEERGLEKLLHLDPPSPLQKPFLPWESDPLPSPPSALSALDVELPPVCYDADI

Tissue specificity:Expressed at low level in most tissues, except in adult testis, where it is highly expressed. Expressed in both spermatocytes and spermatids. 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp