MIOX_RAT   Q9QXN4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9QXN4

Recommended name:Inositol oxygenase

EC number:EC:1.13.99.1

Alternative names:Aldehyde reductase-like 6 Kidney-specific protein 32 Myo-inositol oxygenase (MI oxygenase) Renal-specific oxidoreductase

Cleaved into:

GeneID:252899

Gene names  (primary ):Miox

Gene names  (synonym ):Aldrl6, Ksp32, Rsor

Gene names  (ORF ):

Length:285

Mass:33,185

Sequence:MKVDLGPDPSLVYRPDVDPEMAKSKGSFRNYTSGPLLDRVFTTYKLMHTHQTVDFVMRKRIQFGSFSYKKMTVMEAVDMLDDLVDESDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVGLLHDLGKILALWGEPQWAVVGDTFPVGCRPQASVVFCDSTFQDNPDLQDPRYSTELGMYQPHCGLENVLMSWGHDEYLYQMMKFNKFSLPSEAFYMVRFHSFYPWHTGGDYRQLCSQQDLDMLPWVQEFNKFDLYTKCPDLPEVKSLRPYYQGLIDKYCPGILSW

Tissue specificity:Kidney specific.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp