PLIN5_MOUSE Q8BVZ1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q8BVZ1
Recommended name：Perilipin-5
EC number：
Alternative names：(Lipid droplet-associated protein PAT-1) (Lipid storage droplet protein 5) (Myocardial LD protein)
Cleaved into：
GeneID：66968
Gene names (primary )：Plin5
Gene names (synonym )：Lsdp5 Mldp Oxpat Pat1
Gene names (ORF )：
Length：463
Mass：50474
Sequence：MDQRGEDTTLAPHSRMSGDQTAQDPGSSLGELDQQNVVNRVVALPLVKATCTAVSSAYNSAKDRHPLLGSACRLAEHCVCSVTTCALDHAQPLLEHLQPQLATVNDLACRGLDKLEEKLPFLQQPSDMVVTSAKDTVAKSVTGMVDLAQRGRRWSGELRRSMSQAMDMVLGKSEKLVDRFLPMTEAELAVLAAEAEGPEVGTVEEQRQQQGYFVRLGSLSARLRHLAYEHSLGKLRQSKHRTQEMLAQLQETLELIQHMQRGASPSPTFHPPKTQELWGSWSPCLENGRSHSEVELETLALSRSLTLELQNAVDALAGCVRGLPPSAQAKVAEVQRSVDALQATFADAHCLGDVAPTALAEGRGSVARAHACVDEFLDLVLRAMPLPWLVGPFAPILVEQSEPLINLATCVDEVVGDPDPRWAHMDWPAQKRAWEAESADPGGQEAEPPRGQGKHTMMPELDF
Tissue specificity：Highly expressed in oxidative tissues, including heart, liver, brown adipose tissue (BAT) and slow-twitch fibers of skeletal muscle. Lower expression in epididymal white adipose tissue and anterior tibialis and quadriceps. Expressed in adrenal glands. Isoform 2 has the highest expression in heart. {ECO:0000269|PubMed:16571721, ECO:0000269|PubMed:17130488, ECO:0000269|PubMed:17234449}.
Induction：Up-regulated by fasting, PPARD, PPARA and PLIN4. Increased in muscle of high-fat diet fed mice. Induced by unsaturated long chain fatty acid in muscle. {ECO:0000269|PubMed:16571721, ECO:0000269|PubMed:17130488, ECO:0000269|PubMed:17234449, ECO:0000269|PubMed:23423172, ECO:0000269|PubMed:23606724}.
Developmental stage：
Protein families：Perilipin family