AQP7_MOUSE O54794
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O54794
Recommended name：Aquaporin-7
EC number：
Alternative names：(AQP-7) (Aquaglyceroporin-7)
Cleaved into：
GeneID：11832
Gene names (primary )：Aqp7
Gene names (synonym )：
Gene names (ORF )：
Length：303
Mass：32667
Sequence：MAPRSVLETIQSVLQKNMVREFLAEFLSTYVMMVFGLGSVAHMVLGENSGSYLGVNLGFGFGVTMGVHVAGGISGAHMNAAVTFTNCALGRMTWKKFPVYVLGQFLGSFSAAATTYLIFYGAINHFAGGDLLVTGSKATANIFATYLPEYMTLWRGFLDEAFVTGMLQLCLFAITDKKNSPALQGTEPLVIGILVTVLGVSLGMNSGYAINPSRDLPPRLFTFIAGWGKQVFRAGNNWWWVPVVAPLLGAYLGGIVYLGLIHPSIPQDPQRLENFTARDQKVTASYKNAASANISGSVPLEHF
Tissue specificity：Detected in proximal tubules in kidney (PubMed:15998844, PubMed:17077387). Detected in the capillary network between muscle fibers in skeletal muscle and heart, and in spermatids and on spermatozoa tails in testis and epididymis (PubMed:17077387). Detected in white and brown adipose tissue, especially on small blood vessels (at protein level) (PubMed:15591341, PubMed:17077387, PubMed:25643985). Detected in kidney and white adipose tissue (PubMed:15746100). {ECO:0000269|PubMed:15591341, ECO:0000269|PubMed:15746100, ECO:0000269|PubMed:15998844, ECO:0000269|PubMed:17077387, ECO:0000269|PubMed:25643985}.
Induction：
Developmental stage：
Protein families：MIP/aquaporin (TC 1.A.8) family